SCOPe 2.05: Domain d1cskc_: 1csk C:

Lineage for d1cskc_ (1csk C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries)

8. Domain d1cskc_: 1csk C: [24515]

Details for d1cskc_

PDB Entry: 1csk, 2.5 Å

PDB Description: the crystal structure of human csksh3: structural diversity near the rt-src and n-src loop

PDB Compounds: (C:) c-src sh3 domain

SCOPe Domain Sequences for d1cskc_:

Sequence; same for both SEQRES and ATOM records:

>d1cskc_ b.34.2.1 (C:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

Timeline for d1cskc_:

• d1cskc_ first appeared (with stable ids) in SCOP 1.55
  
• d1cskc_ appears in SCOPe 2.04
  
• d1cskc_ appears in SCOPe 2.06
  
• d1cskc_ appears in the current release, SCOPe 2.08