Lineage for d3afqa_ (3afq A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059459Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2059651Protein automated matches [190206] (9 species)
    not a true protein
  7. 2059702Species Mycobacterium leprae [TaxId:272631] [255745] (2 PDB entries)
  8. 2059705Domain d3afqa_: 3afq A: [245136]
    automated match to d1ue1b_

Details for d3afqa_

PDB Entry: 3afq (more details), 2.8 Å

PDB Description: Crystal structure of the single-stranded DNA binding protein from Mycobacterium leprae (Form II)
PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3afqa_:

Sequence, based on SEQRES records: (download)

>d3afqa_ b.40.4.3 (A:) automated matches {Mycobacterium leprae [TaxId: 272631]}
agdttitivgnltadpelrftssgaavvnftvastpriydrqsgewkdgealflrcniwr
eaaenvaesltrgarvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka

Sequence, based on observed residues (ATOM records): (download)

>d3afqa_ b.40.4.3 (A:) automated matches {Mycobacterium leprae [TaxId: 272631]}
agdttitivgnltadpelrftssgaavvnftvastpkdgealflrcniwreaaenvaesl
trgarvivtgrlkqrsfetrrtvvevevdeigpslryatakvnka

SCOPe Domain Coordinates for d3afqa_:

Click to download the PDB-style file with coordinates for d3afqa_.
(The format of our PDB-style files is described here.)

Timeline for d3afqa_: