Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein automated matches [190206] (10 species) not a true protein |
Species Mycobacterium leprae [TaxId:272631] [255745] (2 PDB entries) |
Domain d3afpb_: 3afp B: [245135] automated match to d1ue1b_ complexed with cd, gol |
PDB Entry: 3afp (more details), 2.05 Å
SCOPe Domain Sequences for d3afpb_:
Sequence, based on SEQRES records: (download)
>d3afpb_ b.40.4.3 (B:) automated matches {Mycobacterium leprae [TaxId: 272631]} agdttitivgnltadpelrftssgaavvnftvastpriydrqsgewkdgealflrcniwr eaaenvaesltrgarvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka
>d3afpb_ b.40.4.3 (B:) automated matches {Mycobacterium leprae [TaxId: 272631]} agdttitivgnltadpelrftssgaavvnftvastpriqsgewkdgealflrcniwreaa envaesltrgarvivtgrlkqrsetregekrtvvevevdeigpslryatakvnka
Timeline for d3afpb_: