Lineage for d3afpa_ (3afp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789537Protein automated matches [190206] (10 species)
    not a true protein
  7. 2789590Species Mycobacterium leprae [TaxId:272631] [255745] (2 PDB entries)
  8. 2789591Domain d3afpa_: 3afp A: [245134]
    automated match to d1ue1b_
    complexed with cd, gol

Details for d3afpa_

PDB Entry: 3afp (more details), 2.05 Å

PDB Description: Crystal structure of the single-stranded DNA binding protein from Mycobacterium leprae (Form I)
PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3afpa_:

Sequence, based on SEQRES records: (download)

>d3afpa_ b.40.4.3 (A:) automated matches {Mycobacterium leprae [TaxId: 272631]}
gdttitivgnltadpelrftssgaavvnftvastpriydrqsgewkdgealflrcniwre
aaenvaesltrgarvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka

Sequence, based on observed residues (ATOM records): (download)

>d3afpa_ b.40.4.3 (A:) automated matches {Mycobacterium leprae [TaxId: 272631]}
gdttitivgnltadpelrftssgaavvnftvastpewkdgealflrcniwreaaenvaes
ltrgarvivtgrlkqrsferegekrtvvevevdeigpslryatakvnka

SCOPe Domain Coordinates for d3afpa_:

Click to download the PDB-style file with coordinates for d3afpa_.
(The format of our PDB-style files is described here.)

Timeline for d3afpa_: