Lineage for d3afkb_ (3afk B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534620Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1534621Protein automated matches [190437] (29 species)
    not a true protein
  7. 1534622Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)
  8. 1534626Domain d3afkb_: 3afk B: [245133]
    automated match to d2zgla_
    complexed with thr

Details for d3afkb_

PDB Entry: 3afk (more details), 1.95 Å

PDB Description: Crystal Structure of Agrocybe aegerita lectin AAL complexed with Thomsen-Friedenreich antigen
PDB Compounds: (B:) Anti-tumor lectin

SCOPe Domain Sequences for d3afkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3afkb_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytglalehhhhh

SCOPe Domain Coordinates for d3afkb_:

Click to download the PDB-style file with coordinates for d3afkb_.
(The format of our PDB-style files is described here.)

Timeline for d3afkb_: