SCOPe 2.06: Domain d3aefb2: 3aef B:115-247

Lineage for d3aefb2 (3aef B:115-247)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [254765] (5 PDB entries)

8. Domain d3aefb2: 3aef B:115-247 [245129]
   Other proteins in same PDB: d3aefa1, d3aefa2, d3aefa3, d3aefb1, d3aefc_, d3aefd_
   automated match to d3ae4b2
   complexed with eph, f3s, fad, fes, hem, sf4

Details for d3aefb2

PDB Entry: 3aef, 2.8 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d3aefb2:

Sequence; same for both SEQRES and ATOM records:

>d3aefb2 a.1.2.1 (B:115-247) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka
iaeikkmmatyke

Timeline for d3aefb2:

• d3aefb2 first appeared in SCOPe 2.04
  
• d3aefb2 appears in SCOPe 2.05
  
• d3aefb2 appears in SCOPe 2.07
  
• d3aefb2 appears in the current release, SCOPe 2.08