Lineage for d3aefa3 (3aef A:446-622)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696597Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 2696598Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 2696637Protein Succinate dehydogenase [81708] (3 species)
  7. 2696659Species Pig (Sus scrofa) [TaxId:9823] [254825] (5 PDB entries)
  8. 2696663Domain d3aefa3: 3aef A:446-622 [245127]
    Other proteins in same PDB: d3aefa1, d3aefa2, d3aefb1, d3aefb2, d3aefc_, d3aefd_
    automated match to d1zoya3
    complexed with eph, f3s, fad, fes, hem, sf4

Details for d3aefa3

PDB Entry: 3aef (more details), 2.8 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3aefa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aefa3 a.7.3.1 (A:446-622) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
ageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsvlqegcekilrlygdlq
hlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrgaharedfkervdeydys
kpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlneadcatvppairsy

SCOPe Domain Coordinates for d3aefa3:

Click to download the PDB-style file with coordinates for d3aefa3.
(The format of our PDB-style files is described here.)

Timeline for d3aefa3: