Lineage for d3aefa2 (3aef A:274-360)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607180Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 2607181Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 2607182Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 2607253Protein Succinate dehydogenase [82818] (3 species)
  7. 2607272Species Pig (Sus scrofa) [TaxId:9823] [254824] (5 PDB entries)
  8. 2607276Domain d3aefa2: 3aef A:274-360 [245126]
    Other proteins in same PDB: d3aefa1, d3aefa3, d3aefb1, d3aefb2, d3aefc_, d3aefd_
    automated match to d1zoya2
    complexed with eph, f3s, fad, fes, hem, sf4

Details for d3aefa2

PDB Entry: 3aef (more details), 2.8 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii with an empty quinone-binding pocket
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3aefa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aefa2 d.168.1.1 (A:274-360) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
gilinsqgerfmeryapvakdlasrdvvsrsmtleiregrgcgpekdhvylqlhhlppeq
lavrlpgisetamifagvdvtkepipv

SCOPe Domain Coordinates for d3aefa2:

Click to download the PDB-style file with coordinates for d3aefa2.
(The format of our PDB-style files is described here.)

Timeline for d3aefa2: