| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) ![]() |
| Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
| Protein Succinate dehydogenase [82818] (2 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [254824] (5 PDB entries) |
| Domain d3aefa2: 3aef A:274-360 [245126] Other proteins in same PDB: d3aefa1, d3aefa3, d3aefb1, d3aefb2, d3aefc_, d3aefd_ automated match to d1zoya2 complexed with eph, f3s, fad, fes, hem, sf4 |
PDB Entry: 3aef (more details), 2.8 Å
SCOPe Domain Sequences for d3aefa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aefa2 d.168.1.1 (A:274-360) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
gilinsqgerfmeryapvakdlasrdvvsrsmtleiregrgcgpekdhvylqlhhlppeq
lavrlpgisetamifagvdvtkepipv
Timeline for d3aefa2:
View in 3DDomains from other chains: (mouse over for more information) d3aefb1, d3aefb2, d3aefc_, d3aefd_ |