| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
| Protein automated matches [191164] (14 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [255742] (4 PDB entries) |
| Domain d3aebb1: 3aeb B:9-114 [245122] Other proteins in same PDB: d3aebb2, d3aebd_ automated match to d1yq3b1 complexed with eph, f3s, f7a, fad, fes, hem, mli, sf4 |
PDB Entry: 3aeb (more details), 3 Å
SCOPe Domain Sequences for d3aebb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aebb1 d.15.4.0 (B:9-114) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd
Timeline for d3aebb1: