Lineage for d3aebb1 (3aeb B:9-114)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894403Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1894404Protein automated matches [191164] (14 species)
    not a true protein
  7. 1894437Species Pig (Sus scrofa) [TaxId:9823] [255742] (4 PDB entries)
  8. 1894438Domain d3aebb1: 3aeb B:9-114 [245122]
    Other proteins in same PDB: d3aebb2, d3aebd_
    automated match to d1yq3b1
    complexed with eph, f3s, f7a, fad, fes, hem, mli, sf4

Details for d3aebb1

PDB Entry: 3aeb (more details), 3 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d3aebb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aebb1 d.15.4.0 (B:9-114) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd

SCOPe Domain Coordinates for d3aebb1:

Click to download the PDB-style file with coordinates for d3aebb1.
(The format of our PDB-style files is described here.)

Timeline for d3aebb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3aebb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3aebd_