SCOPe 2.04: Domain d3ae2b2: 3ae2 B:115-247

Lineage for d3ae2b2 (3ae2 B:115-247)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein automated matches [231469] (4 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [255744] (3 PDB entries)

8. Domain d3ae2b2: 3ae2 B:115-247 [245120]
   Other proteins in same PDB: d3ae2b1, d3ae2d_
   automated match to d1yq3b2
   complexed with eph, f3s, fad, fes, hem, mli, sf4, sli

Details for d3ae2b2

PDB Entry: 3ae2, 3.1 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d3ae2b2:

Sequence; same for both SEQRES and ATOM records:

>d3ae2b2 a.1.2.1 (B:115-247) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka
iaeikkmmatyke

Timeline for d3ae2b2:

• d3ae2b2 is new in SCOPe 2.04-stable
  
• d3ae2b2 appears in SCOPe 2.05
  
• d3ae2b2 appears in the current release, SCOPe 2.08