SCOP 1.75: Domain d2srca1: 2src A:84-145

Lineage for d2srca1 (2src A:84-145)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (39 proteins)

6. Protein c-src protein tyrosine kinase [50064] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50065] (5 PDB entries)

8. Domain d2srca1: 2src A:84-145 [24512]
   Other proteins in same PDB: d2srca2, d2srca3
   complexed with anp

Details for d2srca1

PDB Entry: 2src, 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp

PDB Compounds: (A:) tyrosine-protein kinase src

SCOP Domain Sequences for d2srca1:

Sequence; same for both SEQRES and ATOM records:

>d2srca1 b.34.2.1 (A:84-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
qa

Timeline for d2srca1:

• d2srca1 first appeared (with stable ids) in SCOP 1.55, called d2src_1
  
• d2srca1 appears in SCOP 1.73
  
• d2srca1 appears in SCOPe 2.01
  
• d2srca1 appears in the current release, SCOPe 2.08