Lineage for d3ac0d1 (3ac0 D:3-299)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832028Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2832048Protein Beta-glucosidase [254415] (2 species)
    second beta strand is antiparallel to the rest
  7. 2832049Species Kluyveromyces marxianus [TaxId:4911] [254855] (2 PDB entries)
  8. 2832057Domain d3ac0d1: 3ac0 D:3-299 [245112]
    Other proteins in same PDB: d3ac0a2, d3ac0a3, d3ac0a4, d3ac0b2, d3ac0b3, d3ac0b4, d3ac0c2, d3ac0c3, d3ac0c4, d3ac0d2, d3ac0d3, d3ac0d4
    automated match to d3abza1
    complexed with bgc

Details for d3ac0d1

PDB Entry: 3ac0 (more details), 2.54 Å

PDB Description: crystal structure of beta-glucosidase from kluyveromyces marxianus in complex with glucose
PDB Compounds: (D:) Beta-glucosidase I

SCOPe Domain Sequences for d3ac0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ac0d1 c.1.8.7 (D:3-299) Beta-glucosidase {Kluyveromyces marxianus [TaxId: 4911]}
kfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvpsg
cfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfsedp
ylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrlavk
hanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngldi
efpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengp

SCOPe Domain Coordinates for d3ac0d1:

Click to download the PDB-style file with coordinates for d3ac0d1.
(The format of our PDB-style files is described here.)

Timeline for d3ac0d1: