SCOPe 2.06: Domain d1fmka1: 1fmk A:82-145

Lineage for d1fmka1 (1fmk A:82-145)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein c-src protein tyrosine kinase [50064] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries)

8. Domain d1fmka1: 1fmk A:82-145 [24511]
   Other proteins in same PDB: d1fmka2, d1fmka3

Details for d1fmka1

PDB Entry: 1fmk, 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src

PDB Compounds: (A:) tyrosine-protein kinase src

SCOPe Domain Sequences for d1fmka1:

Sequence; same for both SEQRES and ATOM records:

>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
siqa

Timeline for d1fmka1:

• d1fmka1 first appeared (with stable ids) in SCOP 1.55, called d1fmk_1
  
• d1fmka1 appears in SCOPe 2.05
  
• d1fmka1 appears in SCOPe 2.07
  
• d1fmka1 appears in the current release, SCOPe 2.08