SCOP 1.57: Domain d1fmk_1: 1fmk 82-145

Lineage for d1fmk_1 (1fmk 82-145)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (18 proteins)

6. Protein c-src tyrosine kinase [50064] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries)

8. Domain d1fmk_1: 1fmk 82-145 [24511]
   Other proteins in same PDB: d1fmk_2, d1fmk_3

Details for d1fmk_1

PDB Entry: 1fmk, 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src

SCOP Domain Sequences for d1fmk_1:

Sequence; same for both SEQRES and ATOM records:

>d1fmk_1 b.34.2.1 (82-145) c-src tyrosine kinase {Human (Homo sapiens)}
mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
siqa

Timeline for d1fmk_1:

• d1fmk_1 first appeared (with stable ids) in SCOP 1.55
  
• d1fmk_1 appears in SCOP 1.59
  
• d1fmk_1 appears in the current release, SCOPe 2.08, called d1fmka1