![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.31: Fibronectin III-like [254143] (2 families) ![]() Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2) |
![]() | Family b.1.31.1: Fibronectin III-like [254189] (1 protein) |
![]() | Protein Beta-glucosidase C-terminal domain [254418] (2 species) |
![]() | Species Kluyveromyces marxianus [TaxId:4911] [254860] (2 PDB entries) |
![]() | Domain d3ac0b4: 3ac0 B:721-845 [245107] Other proteins in same PDB: d3ac0a1, d3ac0a2, d3ac0a3, d3ac0b1, d3ac0b2, d3ac0b3, d3ac0c1, d3ac0c2, d3ac0c3, d3ac0d1, d3ac0d2, d3ac0d3 automated match to d3abza4 complexed with bgc |
PDB Entry: 3ac0 (more details), 2.54 Å
SCOPe Domain Sequences for d3ac0b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ac0b4 b.1.31.1 (B:721-845) Beta-glucosidase C-terminal domain {Kluyveromyces marxianus [TaxId: 4911]} ttfeldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekv hlepgekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekel ywkgl
Timeline for d3ac0b4: