![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (1 family) ![]() automatically mapped to Pfam PF01915 |
![]() | Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins) |
![]() | Protein Beta-glucosidase middle domain [254416] (2 species) |
![]() | Species Kluyveromyces marxianus [TaxId:4911] [254857] (2 PDB entries) |
![]() | Domain d3ac0b2: 3ac0 B:300-387,B:560-720 [245105] Other proteins in same PDB: d3ac0a1, d3ac0a3, d3ac0a4, d3ac0b1, d3ac0b3, d3ac0b4, d3ac0c1, d3ac0c3, d3ac0c4, d3ac0d1, d3ac0d3, d3ac0d4 automated match to d3abza2 complexed with bgc |
PDB Entry: 3ac0 (more details), 2.54 Å
SCOPe Domain Sequences for d3ac0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ac0b2 c.23.11.1 (B:300-387,B:560-720) Beta-glucosidase middle domain {Kluyveromyces marxianus [TaxId: 4911]} estsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasm nsyyvvspyegivnklgkevdytvgaysXddeeirnaaelaakhdkavliiglngewete gydrenmdlpkrtnelvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgn aiadvlygdvvpngklslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkv afpfgyglsy
Timeline for d3ac0b2: