Lineage for d3ac0b2 (3ac0 B:300-387,B:560-720)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1588247Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (1 family) (S)
    automatically mapped to Pfam PF01915
  5. 1588248Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins)
  6. 1588260Protein Beta-glucosidase middle domain [254416] (2 species)
  7. 1588261Species Kluyveromyces marxianus [TaxId:4911] [254857] (2 PDB entries)
  8. 1588267Domain d3ac0b2: 3ac0 B:300-387,B:560-720 [245105]
    Other proteins in same PDB: d3ac0a1, d3ac0a3, d3ac0a4, d3ac0b1, d3ac0b3, d3ac0b4, d3ac0c1, d3ac0c3, d3ac0c4, d3ac0d1, d3ac0d3, d3ac0d4
    automated match to d3abza2
    complexed with bgc

Details for d3ac0b2

PDB Entry: 3ac0 (more details), 2.54 Å

PDB Description: crystal structure of beta-glucosidase from kluyveromyces marxianus in complex with glucose
PDB Compounds: (B:) Beta-glucosidase I

SCOPe Domain Sequences for d3ac0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ac0b2 c.23.11.1 (B:300-387,B:560-720) Beta-glucosidase middle domain {Kluyveromyces marxianus [TaxId: 4911]}
estsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasm
nsyyvvspyegivnklgkevdytvgaysXddeeirnaaelaakhdkavliiglngewete
gydrenmdlpkrtnelvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgn
aiadvlygdvvpngklslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkv
afpfgyglsy

SCOPe Domain Coordinates for d3ac0b2:

Click to download the PDB-style file with coordinates for d3ac0b2.
(The format of our PDB-style files is described here.)

Timeline for d3ac0b2: