Lineage for d3ac0a4 (3ac0 A:721-845)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2040231Superfamily b.1.31: Fibronectin III-like [254143] (2 families) (S)
    Pfam PF14310; PubMed 20138890; unclear if related to Fibronectin type III (b.1.2)
  5. 2040232Family b.1.31.1: Fibronectin III-like [254189] (1 protein)
  6. 2040233Protein Beta-glucosidase C-terminal domain [254418] (2 species)
  7. 2040234Species Kluyveromyces marxianus [TaxId:4911] [254860] (2 PDB entries)
  8. 2040239Domain d3ac0a4: 3ac0 A:721-845 [245103]
    Other proteins in same PDB: d3ac0a1, d3ac0a2, d3ac0a3, d3ac0b1, d3ac0b2, d3ac0b3, d3ac0c1, d3ac0c2, d3ac0c3, d3ac0d1, d3ac0d2, d3ac0d3
    automated match to d3abza4
    complexed with bgc

Details for d3ac0a4

PDB Entry: 3ac0 (more details), 2.54 Å

PDB Description: crystal structure of beta-glucosidase from kluyveromyces marxianus in complex with glucose
PDB Compounds: (A:) Beta-glucosidase I

SCOPe Domain Sequences for d3ac0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ac0a4 b.1.31.1 (A:721-845) Beta-glucosidase C-terminal domain {Kluyveromyces marxianus [TaxId: 4911]}
ttfeldisdfkvtddkiaisvdvkntgdkfagsevvqvyfsalnskvsrpvkelkgfekv
hlepgekktvnidlelkdaisyfneelgkwhveageylvsvgtssddilsvkefkvekel
ywkgl

SCOPe Domain Coordinates for d3ac0a4:

Click to download the PDB-style file with coordinates for d3ac0a4.
(The format of our PDB-style files is described here.)

Timeline for d3ac0a4: