Lineage for d3ac0a3 (3ac0 A:388-559)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089592Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2089593Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2089594Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 2089595Protein Beta-glucosidase PA14 domain [254417] (1 species)
  7. 2089596Species Kluyveromyces marxianus [TaxId:4911] [254858] (2 PDB entries)
  8. 2089601Domain d3ac0a3: 3ac0 A:388-559 [245102]
    Other proteins in same PDB: d3ac0a1, d3ac0a2, d3ac0a4, d3ac0b1, d3ac0b2, d3ac0b4, d3ac0c1, d3ac0c2, d3ac0c4, d3ac0d1, d3ac0d2, d3ac0d4
    automated match to d3abza3
    complexed with bgc

Details for d3ac0a3

PDB Entry: 3ac0 (more details), 2.54 Å

PDB Description: crystal structure of beta-glucosidase from kluyveromyces marxianus in complex with glucose
PDB Compounds: (A:) Beta-glucosidase I

SCOPe Domain Sequences for d3ac0a3:

Sequence, based on SEQRES records: (download)

>d3ac0a3 b.179.1.1 (A:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveersddeepfhvtkvnrsnvhlfdf
khekvdpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfc
fgagtkertkkltlkkgqvynvrveygsgptsglvgefgaggfqagvikaid

Sequence, based on observed residues (ATOM records): (download)

>d3ac0a3 b.179.1.1 (A:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveersddeepfhvtkvnrsnvhlfdf
khekvdpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfc
fgagtkertkkltlkkgqvynvrveygsgptsgefgaggfqagvikaid

SCOPe Domain Coordinates for d3ac0a3:

Click to download the PDB-style file with coordinates for d3ac0a3.
(The format of our PDB-style files is described here.)

Timeline for d3ac0a3: