Lineage for d4hck__ (4hck -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.34: SH3-like barrel [50036] (9 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (20 proteins) 
Protein Hemapoetic cell kinase Hck [50062] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50063] (6 PDB entries) 
Domain d4hck__: 4hck - [24510]
Details for d4hck__
PDB Entry: 4hck (more details)
PDB Description: human hck sh3 domain, nmr, 25 structures
SCOP Domain Sequences for d4hck__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hck__ b.34.2.1 (-) Hemapoetic cell kinase Hck {Human (Homo sapiens)}
sediivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
s
SCOP Domain Coordinates for d4hck__:
Click to download the PDB-style file with coordinates for d4hck__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hck__:
- d4hck__ first appeared (with stable ids) in SCOP 1.55
- d4hck__ appears in SCOP 1.57
- d4hck__ appears in SCOP 1.61
- d4hck__ appears in the current release, SCOPe 2.08, called d4hcka_
View in 3D