Lineage for d3abzd3 (3abz D:388-559)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825681Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2825682Superfamily b.179.1: PA14-like [254123] (4 families) (S)
  5. 2825683Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 2825684Protein Beta-glucosidase PA14 domain [254417] (1 species)
  7. 2825685Species Kluyveromyces marxianus [TaxId:4911] [254858] (2 PDB entries)
  8. 2825689Domain d3abzd3: 3abz D:388-559 [245098]
    Other proteins in same PDB: d3abza1, d3abza2, d3abza4, d3abzb1, d3abzb2, d3abzb4, d3abzc1, d3abzc2, d3abzc4, d3abzd1, d3abzd2, d3abzd4
    automated match to d3abza3
    complexed with gol

    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d3abzd3

PDB Entry: 3abz (more details), 2.15 Å

PDB Description: Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus
PDB Compounds: (D:) Beta-glucosidase I

SCOPe Domain Sequences for d3abzd3:

Sequence, based on SEQRES records: (download)

>d3abzd3 b.179.1.1 (D:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveersddeepfhvtkvnrsnvhlfdf
khekvdpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfc
fgagtkertkkltlkkgqvynvrveygsgptsglvgefgaggfqagvikaid

Sequence, based on observed residues (ATOM records): (download)

>d3abzd3 b.179.1.1 (D:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveeepfhvtkvnrsnvhlfdfkhekv
dpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfcfgagt
kertkkltlkkgqvynvrveygsgptsgaggfqagvikaid

SCOPe Domain Coordinates for d3abzd3:

Click to download the PDB-style file with coordinates for d3abzd3.
(The format of our PDB-style files is described here.)

Timeline for d3abzd3: