Lineage for d3abzd1 (3abz D:2-299)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832028Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2832048Protein Beta-glucosidase [254415] (2 species)
    second beta strand is antiparallel to the rest
  7. 2832049Species Kluyveromyces marxianus [TaxId:4911] [254855] (2 PDB entries)
  8. 2832053Domain d3abzd1: 3abz D:2-299 [245096]
    Other proteins in same PDB: d3abza2, d3abza3, d3abza4, d3abzb2, d3abzb3, d3abzb4, d3abzc2, d3abzc3, d3abzc4, d3abzd2, d3abzd3, d3abzd4
    automated match to d3abza1
    complexed with gol

Details for d3abzd1

PDB Entry: 3abz (more details), 2.15 Å

PDB Description: Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus
PDB Compounds: (D:) Beta-glucosidase I

SCOPe Domain Sequences for d3abzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abzd1 c.1.8.7 (D:2-299) Beta-glucosidase {Kluyveromyces marxianus [TaxId: 4911]}
skfdveqllselnqdekisllsavdfwhtkkierlgipavrvsdgpngirgtkffdgvps
gcfpngtglastfdrdlletagklmakesiaknaavilgpttnmqrgplggrgfesfsed
pylagmatssvvkgmqgegiaatvkhfvcndledqrfssnsivseralreiylepfrlav
khanpvcimtaynkvngehcsqskkllidilrdewkwdgmlmsdwfgtyttaaaikngld
iefpgptrwrtralvshslnsreqittedvddrvrqvlkmikfvvdnlektgivengp

SCOPe Domain Coordinates for d3abzd1:

Click to download the PDB-style file with coordinates for d3abzd1.
(The format of our PDB-style files is described here.)

Timeline for d3abzd1: