| Class b: All beta proteins [48724] (180 folds) |
| Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily) core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains |
Superfamily b.179.1: PA14-like [254123] (4 families) ![]() |
| Family b.179.1.1: PA14 [254147] (2 proteins) Pfam PF07691 |
| Protein Beta-glucosidase PA14 domain [254417] (1 species) |
| Species Kluyveromyces marxianus [TaxId:4911] [254858] (2 PDB entries) |
| Domain d3abzc3: 3abz C:388-559 [245094] Other proteins in same PDB: d3abza1, d3abza2, d3abza4, d3abzb1, d3abzb2, d3abzb4, d3abzc1, d3abzc2, d3abzc4, d3abzd1, d3abzd2, d3abzd4 automated match to d3abza3 complexed with gol applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 3abz (more details), 2.15 Å
SCOPe Domain Sequences for d3abzc3:
Sequence, based on SEQRES records: (download)
>d3abzc3 b.179.1.1 (C:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveersddeepfhvtkvnrsnvhlfdf
khekvdpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfc
fgagtkertkkltlkkgqvynvrveygsgptsglvgefgaggfqagvikaid
>d3abzc3 b.179.1.1 (C:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveersddeepfhvtkvnrsnvhlfdf
khekvdpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfc
fgagtkertkkltlkkgqvynvrveygsgpgaggfqagvikaid
Timeline for d3abzc3: