Lineage for d5hcka_ (5hck A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796326Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 796327Species Human (Homo sapiens) [TaxId:9606] [50063] (6 PDB entries)
  8. 796339Domain d5hcka_: 5hck A: [24509]

Details for d5hcka_

PDB Entry: 5hck (more details)

PDB Description: human hck sh3 domain, nmr, minimized average structure
PDB Compounds: (A:) hematopoietic cell kinase

SCOP Domain Sequences for d5hcka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hcka_ b.34.2.1 (A:) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
sediivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
s

SCOP Domain Coordinates for d5hcka_:

Click to download the PDB-style file with coordinates for d5hcka_.
(The format of our PDB-style files is described here.)

Timeline for d5hcka_: