Lineage for d5hck__ (5hck -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13168Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 13169Species Human (Homo sapiens) [TaxId:9606] [50063] (6 PDB entries)
  8. 13181Domain d5hck__: 5hck - [24509]

Details for d5hck__

PDB Entry: 5hck (more details)

PDB Description: human hck sh3 domain, nmr, minimized average structure

SCOP Domain Sequences for d5hck__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hck__ b.34.2.1 (-) Hemapoetic cell kinase Hck {Human (Homo sapiens)}
sediivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
s

SCOP Domain Coordinates for d5hck__:

Click to download the PDB-style file with coordinates for d5hck__.
(The format of our PDB-style files is described here.)

Timeline for d5hck__: