Lineage for d5hcka_ (5hck A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783072Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2783073Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2783120Domain d5hcka_: 5hck A: [24509]

Details for d5hcka_

PDB Entry: 5hck (more details)

PDB Description: human hck sh3 domain, nmr, minimized average structure
PDB Compounds: (A:) hematopoietic cell kinase

SCOPe Domain Sequences for d5hcka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hcka_ b.34.2.1 (A:) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
sediivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
s

SCOPe Domain Coordinates for d5hcka_:

Click to download the PDB-style file with coordinates for d5hcka_.
(The format of our PDB-style files is described here.)

Timeline for d5hcka_: