Lineage for d3abza2 (3abz A:300-387,A:560-720)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465847Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2465848Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain-like [52280] (3 proteins)
  6. 2465868Protein Beta-glucosidase middle domain [254416] (2 species)
  7. 2465869Species Kluyveromyces marxianus [TaxId:4911] [254857] (2 PDB entries)
  8. 2465870Domain d3abza2: 3abz A:300-387,A:560-720 [245085]
    Other proteins in same PDB: d3abza1, d3abza3, d3abza4, d3abzb1, d3abzb3, d3abzb4, d3abzc1, d3abzc3, d3abzc4, d3abzd1, d3abzd3, d3abzd4
    complexed with gol

Details for d3abza2

PDB Entry: 3abz (more details), 2.15 Å

PDB Description: Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus
PDB Compounds: (A:) Beta-glucosidase I

SCOPe Domain Sequences for d3abza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abza2 c.23.11.1 (A:300-387,A:560-720) Beta-glucosidase middle domain {Kluyveromyces marxianus [TaxId: 4911]}
estsnntketsdllrkiaadsivllknknnilplkkedniivigpnakaktssgggsasm
nsyyvvspyegivnklgkevdytvgaysXddeeirnaaelaakhdkavliiglngewete
gydrenmdlpkrtnelvravlkanpntvivnqsgtpvefpwledanalvqawyggnelgn
aiadvlygdvvpngklslswpfklqdnpaflnfktefgrviygedifvgyryyeklqrkv
afpfgyglsy

SCOPe Domain Coordinates for d3abza2:

Click to download the PDB-style file with coordinates for d3abza2.
(The format of our PDB-style files is described here.)

Timeline for d3abza2: