Lineage for d3a9ba_ (3a9b A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833668Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1833669Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 1833735Family c.6.1.0: automated matches [195757] (1 protein)
    not a true family
  6. 1833736Protein automated matches [195758] (1 species)
    not a true protein
  7. 1833737Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [195759] (8 PDB entries)
  8. 1833738Domain d3a9ba_: 3a9b A: [245072]
    automated match to d1qk2a_
    complexed with bgc, cbi, mg

Details for d3a9ba_

PDB Entry: 3a9b (more details), 1.2 Å

PDB Description: cccel6c, a glycoside hydrolase family 6 enzyme, complexed with cellobiose
PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3a9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9ba_ c.6.1.0 (A:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
svnpyigrsplviksyaekleetiayfeaqgdelnaartrtvqgiptfawisdsatidti
qpliadavahqeasgeqvlvqlviynlpdrdcaakasdgefhldddgankyrayvdriva
elstadadklhfsivlepdslgnmvtnmhvpkcqgaataykegiaytiaslqkpnidlyi
daahggwlgwndnlrpsaeifketldlarqitpnatvrglainvsnynpyktraredyte
wnnaydewnyvktltphlqavgfpaqfivdqgrsgregirtewgqwcnirnagfgirptt
dqaivdsanvdaivwvkpggesdgtsdvnavrfdencrspashvpapeagewfnefvvnl
vinanppleptyaa

SCOPe Domain Coordinates for d3a9ba_:

Click to download the PDB-style file with coordinates for d3a9ba_.
(The format of our PDB-style files is described here.)

Timeline for d3a9ba_: