SCOPe 2.04: Domain d3a5zb2: 3a5z B:66-136

Lineage for d3a5zb2 (3a5z B:66-136)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (22 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255345] (2 PDB entries)

8. Domain d3a5zb2: 3a5z B:66-136 [245061]
   Other proteins in same PDB: d3a5zb1
   automated match to d3trea2
   protein/RNA complex; complexed with kaa

Details for d3a5zb2

PDB Entry: 3a5z, 2.5 Å

PDB Description: Crystal structure of Escherichia coli GenX in complex with elongation factor P

PDB Compounds: (B:) elongation factor P

SCOPe Domain Sequences for d3a5zb2:

Sequence; same for both SEQRES and ATOM records:

>d3a5zb2 b.40.4.0 (B:66-136) automated matches {Escherichia coli [TaxId: 562]}
dvvdmnltylyndgefwhfmnnetfeqlsadakaigdnakwlldqaecivtlwngqpisv
tppnfveleiv

Timeline for d3a5zb2:

• d3a5zb2 is new in SCOPe 2.04-stable
  
• d3a5zb2 appears in SCOPe 2.05
  
• d3a5zb2 appears in the current release, SCOPe 2.08