Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Escherichia coli [TaxId:562] [255345] (2 PDB entries) |
Domain d3a5zb2: 3a5z B:66-136 [245061] Other proteins in same PDB: d3a5zb1 automated match to d3trea2 protein/RNA complex; complexed with kaa |
PDB Entry: 3a5z (more details), 2.5 Å
SCOPe Domain Sequences for d3a5zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a5zb2 b.40.4.0 (B:66-136) automated matches {Escherichia coli [TaxId: 562]} dvvdmnltylyndgefwhfmnnetfeqlsadakaigdnakwlldqaecivtlwngqpisv tppnfveleiv
Timeline for d3a5zb2: