SCOPe 2.08: Domain d3a5zb1: 3a5z B:3-65

Lineage for d3a5zb1 (3a5z B:3-65)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255739] (1 PDB entry)

8. Domain d3a5zb1: 3a5z B:3-65 [245060]
   Other proteins in same PDB: d3a5zb2
   automated match to d3trea1
   protein/RNA complex; complexed with kaa

Details for d3a5zb1

PDB Entry: 3a5z, 2.5 Å

PDB Description: Crystal structure of Escherichia coli GenX in complex with elongation factor P

PDB Compounds: (B:) elongation factor P

SCOPe Domain Sequences for d3a5zb1:

Sequence; same for both SEQRES and ATOM records:

>d3a5zb1 b.34.5.0 (B:3-65) automated matches {Escherichia coli [TaxId: 562]}
tyysndfraglkimldgepyaveasefvkpgkgqafarvklrrlltgtrvektfkstdsa
ega

Timeline for d3a5zb1:

• d3a5zb1 first appeared in SCOPe 2.04
  
• d3a5zb1 appears in SCOPe 2.07