![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.0: automated matches [227245] (1 protein) not a true family |
![]() | Protein automated matches [227015] (11 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [255739] (1 PDB entry) |
![]() | Domain d3a5zb1: 3a5z B:3-65 [245060] Other proteins in same PDB: d3a5zb2 automated match to d3trea1 protein/RNA complex; complexed with kaa |
PDB Entry: 3a5z (more details), 2.5 Å
SCOPe Domain Sequences for d3a5zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a5zb1 b.34.5.0 (B:3-65) automated matches {Escherichia coli [TaxId: 562]} tyysndfraglkimldgepyaveasefvkpgkgqafarvklrrlltgtrvektfkstdsa ega
Timeline for d3a5zb1: