SCOPe 2.05: Domain d3a4vb_: 3a4v B:

Lineage for d3a4vb_ (3a4v B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:50339] [255738] (3 PDB entries)

8. Domain d3a4vb_: 3a4v B: [245059]
   automated match to d2p4hx_
   complexed with mpd, nad, pyr

Details for d3a4vb_

PDB Entry: 3a4v, 1.78 Å

PDB Description: Crystal structure of pyruvate bound L-Threonine dehydrogenase from Hyperthermophilic Archaeon Thermoplasma volcanium

PDB Compounds: (B:) NDP-sugar epimerase

SCOPe Domain Sequences for d3a4vb_:

Sequence; same for both SEQRES and ATOM records:

>d3a4vb_ c.2.1.0 (B:) automated matches {Thermoplasma volcanium [TaxId: 50339]}
milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
pknkvpsititrprtmygvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
midhisek

Timeline for d3a4vb_:

• d3a4vb_ first appeared in SCOPe 2.04
  
• d3a4vb_ appears in SCOPe 2.06
  
• d3a4vb_ appears in the current release, SCOPe 2.08