Lineage for d3a1na_ (3a1n A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581631Species Thermoplasma volcanium [TaxId:50339] [255738] (3 PDB entries)
  8. 1581636Domain d3a1na_: 3a1n A: [245055]
    automated match to d2p4hx_
    complexed with nad

Details for d3a1na_

PDB Entry: 3a1n (more details), 2.07 Å

PDB Description: Crystal structure of L-Threonine dehydrogenase from Hyperthermophilic Archaeon Thermoplasma volcanium
PDB Compounds: (A:) NDP-sugar epimerase

SCOPe Domain Sequences for d3a1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a1na_ c.2.1.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 50339]}
milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
pknkvpsititrprtmygvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
midhiseklgiegkh

SCOPe Domain Coordinates for d3a1na_:

Click to download the PDB-style file with coordinates for d3a1na_.
(The format of our PDB-style files is described here.)

Timeline for d3a1na_: