![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces sp. [TaxId:171258] [255721] (3 PDB entries) |
![]() | Domain d3a1la_: 3a1l A: [245054] automated match to d3weca_ complexed with 2cc, hem |
PDB Entry: 3a1l (more details), 2.5 Å
SCOPe Domain Sequences for d3a1la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a1la_ a.104.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 171258]} atlprfdlmgwdkkdiadpypvyrryreaapvhrtasgpgkpdtyyvftyddvvrvlsnr rlgrnarvasgdtdtapvpiptehralrtvvenwlvfldpphhtelrsllttefspsivt glrpriaelasalldrlraqrrpdlvegfaaplpilvisallgipeedhtwlranavalq easttrardgrgyaraeaasqeftryfrrevdrrggddrddlltllvrardtgsplsvdg ivgtcvhlltaghetttnflakavltlrahrdvldelrttpestpaaveelmrydppvqa vtrwayedirlgdhdiprgsrvvallgsanrdparfpdpdvldvhraaerqvgfglgihy clgatlaraeaeiglralldgipalgrgaheveyaddmvfhgptrllldlp
Timeline for d3a1la_: