Lineage for d3a1la_ (3a1l A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2332214Species Streptomyces sp. [TaxId:171258] [255721] (3 PDB entries)
  8. 2332220Domain d3a1la_: 3a1l A: [245054]
    automated match to d3weca_
    complexed with 2cc, hem

Details for d3a1la_

PDB Entry: 3a1l (more details), 2.5 Å

PDB Description: crystal structure of 11,11'-dichlorochromopyrrolic acid bound cytochrome p450 stap (cyp245a1)
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d3a1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a1la_ a.104.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 171258]}
atlprfdlmgwdkkdiadpypvyrryreaapvhrtasgpgkpdtyyvftyddvvrvlsnr
rlgrnarvasgdtdtapvpiptehralrtvvenwlvfldpphhtelrsllttefspsivt
glrpriaelasalldrlraqrrpdlvegfaaplpilvisallgipeedhtwlranavalq
easttrardgrgyaraeaasqeftryfrrevdrrggddrddlltllvrardtgsplsvdg
ivgtcvhlltaghetttnflakavltlrahrdvldelrttpestpaaveelmrydppvqa
vtrwayedirlgdhdiprgsrvvallgsanrdparfpdpdvldvhraaerqvgfglgihy
clgatlaraeaeiglralldgipalgrgaheveyaddmvfhgptrllldlp

SCOPe Domain Coordinates for d3a1la_:

Click to download the PDB-style file with coordinates for d3a1la_.
(The format of our PDB-style files is described here.)

Timeline for d3a1la_: