SCOPe 2.05: Domain d2zyqa2: 2zyq A:133-297

Lineage for d2zyqa2 (2zyq A:133-297)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (18 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [231709] (2 PDB entries)

8. Domain d2zyqa2: 2zyq A:133-297 [245049]
   automated match to d2zi8a2
   complexed with fe2, tar

Details for d2zyqa2

PDB Entry: 2zyq, 2 Å

PDB Description: Crystal structure of the HsaC extradiol dioxygenase from M. tuberculosis

PDB Compounds: (A:) probable biphenyl-2,3-diol 1,2-dioxygenase bphc

SCOPe Domain Sequences for d2zyqa2:

Sequence; same for both SEQRES and ATOM records:

>d2zyqa2 d.32.1.0 (A:133-297) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ghrfvtgeqgmghvvlstrddaealhfyrdvlgfrlrdsmrlppqmvgrpadgppawlrf
fgcnprhhslaflpmptssgivhlmveveqaddvglcldralrrkvpmsatlgrhvndlm
lsfymktpggfdiefgcegrqvddrdwiarestavslwghdftvg

Timeline for d2zyqa2:

• d2zyqa2 first appeared in SCOPe 2.04
  
• d2zyqa2 appears in SCOPe 2.06
  
• d2zyqa2 appears in the current release, SCOPe 2.08