Lineage for d2zxaa2 (2zxa A:357-447)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400933Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2400934Protein automated matches [226835] (35 species)
    not a true protein
  7. 2401131Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries)
  8. 2401144Domain d2zxaa2: 2zxa A:357-447 [245037]
    Other proteins in same PDB: d2zxaa1, d2zxaa3, d2zxab1, d2zxab3
    automated match to d2zwyb2
    complexed with zxa

Details for d2zxaa2

PDB Entry: 2zxa (more details), 2.57 Å

PDB Description: alpha-l-fucosidase complexed with inhibitor, fnj-acetyl
PDB Compounds: (A:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zxaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxaa2 b.71.1.0 (A:357-447) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

SCOPe Domain Coordinates for d2zxaa2:

Click to download the PDB-style file with coordinates for d2zxaa2.
(The format of our PDB-style files is described here.)

Timeline for d2zxaa2: