Lineage for d2zx6b2 (2zx6 B:357-448)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077462Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2077463Protein automated matches [226835] (34 species)
    not a true protein
  7. 2077660Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries)
  8. 2077668Domain d2zx6b2: 2zx6 B:357-448 [245023]
    Other proteins in same PDB: d2zx6a1, d2zx6b1
    automated match to d2zwyb2
    complexed with zx6

Details for d2zx6b2

PDB Entry: 2zx6 (more details), 2.42 Å

PDB Description: alpha-l-fucosidase complexed with inhibitor, f10-1c
PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zx6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zx6b2 b.71.1.0 (B:357-448) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleave

SCOPe Domain Coordinates for d2zx6b2:

Click to download the PDB-style file with coordinates for d2zx6b2.
(The format of our PDB-style files is described here.)

Timeline for d2zx6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zx6b1