Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (34 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries) |
Domain d2zx6a2: 2zx6 A:357-448 [245021] Other proteins in same PDB: d2zx6a1, d2zx6b1 automated match to d2zwyb2 complexed with zx6 |
PDB Entry: 2zx6 (more details), 2.42 Å
SCOPe Domain Sequences for d2zx6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zx6a2 b.71.1.0 (A:357-448) automated matches {Thermotoga maritima [TaxId: 2336]} gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger lsfknvgknleitvpkklletdsitlvleave
Timeline for d2zx6a2: