Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (16 species) not a true protein |
Species Escherichia coli [TaxId:155864] [255736] (1 PDB entry) |
Domain d2zwke2: 2zwk E:95-188 [245015] Other proteins in same PDB: d2zwka1, d2zwkc1, d2zwke1 automated match to d2zqka2 |
PDB Entry: 2zwk (more details), 3.1 Å
SCOPe Domain Sequences for d2zwke2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwke2 d.169.1.0 (E:95-188) automated matches {Escherichia coli [TaxId: 155864]} ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss eqrsgvsstynlitqnplpgvnvntpnvyavcve
Timeline for d2zwke2:
View in 3D Domains from other chains: (mouse over for more information) d2zwka1, d2zwka2, d2zwkc1, d2zwkc2 |