SCOPe 2.06: Domain d2zwke2: 2zwk E:95-188

Lineage for d2zwke2 (2zwk E:95-188)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:155864] [255736] (1 PDB entry)

8. Domain d2zwke2: 2zwk E:95-188 [245015]
   Other proteins in same PDB: d2zwka1, d2zwkc1, d2zwke1
   automated match to d2zqka2

Details for d2zwke2

PDB Entry: 2zwk, 3.1 Å

PDB Description: Crystal structure of intimin-Tir90 complex

PDB Compounds: (E:) intimin

SCOPe Domain Sequences for d2zwke2:

Sequence; same for both SEQRES and ATOM records:

>d2zwke2 d.169.1.0 (E:95-188) automated matches {Escherichia coli [TaxId: 155864]}
ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss
eqrsgvsstynlitqnplpgvnvntpnvyavcve

Timeline for d2zwke2:

• d2zwke2 first appeared in SCOPe 2.04
  
• d2zwke2 appears in SCOPe 2.05
  
• d2zwke2 appears in SCOPe 2.07
  
• d2zwke2 appears in the current release, SCOPe 2.08