| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
| Family b.1.14.0: automated matches [231720] (1 protein) not a true family |
| Protein automated matches [231721] (3 species) not a true protein |
| Species Escherichia coli [TaxId:544404] [233003] (3 PDB entries) |
| Domain d2zwke1: 2zwk E:6-94 [245014] Other proteins in same PDB: d2zwka2, d2zwkc2, d2zwke2 automated match to d3ncxb1 |
PDB Entry: 2zwk (more details), 3.1 Å
SCOPe Domain Sequences for d2zwke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwke1 b.1.14.0 (E:6-94) automated matches {Escherichia coli [TaxId: 544404]}
ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
vtlngkgsvvikatsgdkqtvsytikaps
Timeline for d2zwke1:
View in 3DDomains from other chains: (mouse over for more information) d2zwka1, d2zwka2, d2zwkc1, d2zwkc2 |