![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
![]() | Family b.1.14.0: automated matches [231720] (1 protein) not a true family |
![]() | Protein automated matches [231721] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:155864] [255735] (1 PDB entry) |
![]() | Domain d2zwkc1: 2zwk C:6-94 [245012] Other proteins in same PDB: d2zwka2, d2zwkc2, d2zwke2 automated match to d3ncxb1 |
PDB Entry: 2zwk (more details), 3.1 Å
SCOPe Domain Sequences for d2zwkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwkc1 b.1.14.0 (C:6-94) automated matches {Escherichia coli [TaxId: 155864]} ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk vtlngkgsvvikatsgdkqtvsytikaps
Timeline for d2zwkc1:
![]() Domains from other chains: (mouse over for more information) d2zwka1, d2zwka2, d2zwke1, d2zwke2 |