SCOPe 2.08: Domain d2zwkc1: 2zwk C:6-94

Lineage for d2zwkc1 (2zwk C:6-94)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.0: automated matches [231720] (1 protein)
   not a true family

6. Protein automated matches [231721] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:155864] [255735] (1 PDB entry)

8. Domain d2zwkc1: 2zwk C:6-94 [245012]
   Other proteins in same PDB: d2zwka2, d2zwkc2, d2zwke2
   automated match to d3ncxb1

Details for d2zwkc1

PDB Entry: 2zwk, 3.1 Å

PDB Description: Crystal structure of intimin-Tir90 complex

PDB Compounds: (C:) intimin

SCOPe Domain Sequences for d2zwkc1:

Sequence; same for both SEQRES and ATOM records:

>d2zwkc1 b.1.14.0 (C:6-94) automated matches {Escherichia coli [TaxId: 155864]}
ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
vtlngkgsvvikatsgdkqtvsytikaps

Timeline for d2zwkc1:

• d2zwkc1 first appeared in SCOPe 2.04
  
• d2zwkc1 appears in SCOPe 2.07