![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (19 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [231724] (2 PDB entries) |
![]() | Domain d2zwka2: 2zwk A:95-188 [245011] Other proteins in same PDB: d2zwka1, d2zwkc1, d2zwke1 automated match to d2zqka2 |
PDB Entry: 2zwk (more details), 3.1 Å
SCOPe Domain Sequences for d2zwka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwka2 d.169.1.0 (A:95-188) automated matches {Escherichia coli [TaxId: 83334]} ymikvdkqayyadamsicknllpstqtvlsdiydswgaankyshyssmnsitawikqtss eqrsgvsstynlitqnplpgvnvntpnvyavcve
Timeline for d2zwka2:
![]() Domains from other chains: (mouse over for more information) d2zwkc1, d2zwkc2, d2zwke1, d2zwke2 |