Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) |
Family b.1.14.0: automated matches [231720] (1 protein) not a true family |
Protein automated matches [231721] (3 species) not a true protein |
Species Escherichia coli [TaxId:544404] [233003] (3 PDB entries) |
Domain d2zwka1: 2zwk A:6-94 [245010] Other proteins in same PDB: d2zwka2, d2zwkc2, d2zwke2 automated match to d3ncxb1 |
PDB Entry: 2zwk (more details), 3.1 Å
SCOPe Domain Sequences for d2zwka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwka1 b.1.14.0 (A:6-94) automated matches {Escherichia coli [TaxId: 544404]} ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk vtlngkgsvvikatsgdkqtvsytikaps
Timeline for d2zwka1:
View in 3D Domains from other chains: (mouse over for more information) d2zwkc1, d2zwkc2, d2zwke1, d2zwke2 |