Lineage for d2zwka1 (2zwk A:6-94)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523674Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) (S)
  5. 1523689Family b.1.14.0: automated matches [231720] (1 protein)
    not a true family
  6. 1523690Protein automated matches [231721] (3 species)
    not a true protein
  7. 1523693Species Escherichia coli [TaxId:544404] [233003] (3 PDB entries)
  8. 1523700Domain d2zwka1: 2zwk A:6-94 [245010]
    Other proteins in same PDB: d2zwka2, d2zwkc2, d2zwke2
    automated match to d3ncxb1

Details for d2zwka1

PDB Entry: 2zwk (more details), 3.1 Å

PDB Description: Crystal structure of intimin-Tir90 complex
PDB Compounds: (A:) intimin

SCOPe Domain Sequences for d2zwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwka1 b.1.14.0 (A:6-94) automated matches {Escherichia coli [TaxId: 544404]}
ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
vtlngkgsvvikatsgdkqtvsytikaps

SCOPe Domain Coordinates for d2zwka1:

Click to download the PDB-style file with coordinates for d2zwka1.
(The format of our PDB-style files is described here.)

Timeline for d2zwka1: