SCOPe 2.04: Domain d2zwga_: 2zwg A:

Lineage for d2zwga_ (2zwg A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.3: Tyrosinase [254185] (1 protein)
   Pfam PF00264

6. Protein Tyrosinase [254409] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (22 PDB entries)

8. Domain d2zwga_: 2zwg A: [245008]
   Other proteins in same PDB: d2zwgb_
   automated match to d2ahka_
   complexed with cu, no3

Details for d2zwga_

PDB Entry: 2zwg, 1.32 Å

PDB Description: Crystal structure of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking the deoxy-form crystal in dioxygen-saturated solution for 12 hours

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d2zwga_:

Sequence; same for both SEQRES and ATOM records:

>d2zwga_ a.86.1.3 (A:) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfdalehh

Timeline for d2zwga_:

• d2zwga_ is new in SCOPe 2.04-stable
  
• d2zwga_ appears in SCOPe 2.05
  
• d2zwga_ appears in the current release, SCOPe 2.08, called d2zwga1