SCOPe 2.08: Domain d2zweb_: 2zwe B:

Lineage for d2zweb_ (2zwe B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries)

8. Domain d2zweb_: 2zwe B: [245005]
   Other proteins in same PDB: d2zwea1, d2zwea2
   automated match to d2ahkb_
   complexed with cu, no3

Details for d2zweb_

PDB Entry: 2zwe, 1.32 Å

PDB Description: Crystal structure of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking the deoxy-form crystal in dioxygen-saturated solution for 40 minutes

PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d2zweb_:

Sequence, based on SEQRES records:

>d2zweb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshfd
pvptpraaaraavdelqgapllpf

Sequence, based on observed residues (ATOM records):

>d2zweb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshfdpvptpr
aaaraavdelqgapllpf

Timeline for d2zweb_:

• d2zweb_ first appeared in SCOPe 2.04
  
• d2zweb_ appears in SCOPe 2.07