Lineage for d2zwea_ (2zwe A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496574Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 1496575Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 1496612Family a.86.1.3: Tyrosinase [254185] (1 protein)
    Pfam PF00264
  6. 1496613Protein Tyrosinase [254409] (1 species)
  7. 1496614Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (22 PDB entries)
  8. 1496621Domain d2zwea_: 2zwe A: [245004]
    Other proteins in same PDB: d2zweb_
    automated match to d2ahka_
    complexed with cu, no3

Details for d2zwea_

PDB Entry: 2zwe (more details), 1.32 Å

PDB Description: Crystal structure of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking the deoxy-form crystal in dioxygen-saturated solution for 40 minutes
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d2zwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwea_ a.86.1.3 (A:) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfdalehh

SCOPe Domain Coordinates for d2zwea_:

Click to download the PDB-style file with coordinates for d2zwea_.
(The format of our PDB-style files is described here.)

Timeline for d2zwea_: