Class a: All alpha proteins [46456] (285 folds) |
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) duplication: contains two structural repeats |
Family a.86.1.3: Tyrosinase [254185] (1 protein) Pfam PF00264 |
Protein Tyrosinase [254409] (1 species) |
Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (22 PDB entries) |
Domain d2zwea_: 2zwe A: [245004] Other proteins in same PDB: d2zweb_ automated match to d2ahka_ complexed with cu, no3 |
PDB Entry: 2zwe (more details), 1.32 Å
SCOPe Domain Sequences for d2zwea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwea_ a.86.1.3 (A:) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]} tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt pdvvdlnetmkpwntvrpadlldhtayytfdalehh
Timeline for d2zwea_: