![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
![]() | Domain d2zrsb_: 2zrs B: [244978] automated match to d3aaja_ complexed with ca |
PDB Entry: 2zrs (more details), 3.1 Å
SCOPe Domain Sequences for d2zrsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zrsb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfsef tgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdrqgrgq iafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvf
Timeline for d2zrsb_: