Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) |
Family d.48.1.0: automated matches [227236] (1 protein) not a true family |
Protein automated matches [226990] (3 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [225585] (8 PDB entries) |
Domain d2zrda2: 2zrd A:271-334 [244974] Other proteins in same PDB: d2zrda1 automated match to d2zrma2 complexed with adp |
PDB Entry: 2zrd (more details), 3.1 Å
SCOPe Domain Sequences for d2zrda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zrda2 d.48.1.0 (A:271-334) automated matches {Mycobacterium smegmatis [TaxId: 246196]} sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg igav
Timeline for d2zrda2: